PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10007810m
Common NameCARUB_v10007810mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 282aa    MW: 31601.6 Da    PI: 5.3797
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10007810mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.31.5e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d+++ +G+g+W+  ++  g+ R++k+c++rw +yl
  Carubv10007810m 14 KGPWTAEEDQKLIDYIRFHGPGNWRILPKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding54.33e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  +G++ W++Ia++++ gRt++++k++w+++
  Carubv10007810m  67 RGRFSFEEEETIIQLHSVMGNK-WSAIAARLP-GRTDNEIKNHWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-25564IPR009057Homeodomain-like
PROSITE profilePS5129418.587961IPR017930Myb domain
SuperFamilySSF466892.92E-3111108IPR009057Homeodomain-like
SMARTSM007174.5E-141363IPR001005SANT/Myb domain
PfamPF002491.1E-151461IPR001005SANT/Myb domain
CDDcd001671.88E-121661No hitNo description
PROSITE profilePS5129425.80462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.1E-2765117IPR009057Homeodomain-like
SMARTSM007172.7E-1666114IPR001005SANT/Myb domain
PfamPF002491.6E-1567111IPR001005SANT/Myb domain
CDDcd001671.84E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0010200Biological Processresponse to chitin
GO:0016049Biological Processcell growth
GO:0042335Biological Processcuticle development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0080091Biological Processregulation of raffinose metabolic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MGRSPCCDKN GVKKGPWTAE EDQKLIDYIR FHGPGNWRIL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIQ LHSVMGNKWS AIAARLPGRT DNEIKNHWNT HIRKRLVRSG  120
IDPVTHSPRL DLLDLSSLLS VLLSQPNFSS VATQASSLLN PDVLRLAFLL FPLQNPNPIY  180
SPNLDQNLQT PITSSESSQP QTESTTPTNN ETSSLEPMNA RLDDVGPVDV LPPLSESFDL  240
DSLMSTPMSS PQQKSIEAEA NPSSFFDFGF PDDFILDDFM F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-31141167108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00457DAPTransfer from AT4G28110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196100.0AY519610.1 Arabidopsis thaliana MYB transcription factor (At4g28110) mRNA, complete cds.
GenBankBT0019300.0BT001930.1 Arabidopsis thaliana clone C103440 putative myb family transcription factor (At4g28110) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006286241.10.0hypothetical protein CARUB_v10007810mg
SwissprotQ8GWP01e-71MYB39_ARATH; Transcription factor MYB39
TrEMBLR0GQH10.0R0GQH1_9BRAS; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_70011081e-178(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28110.11e-141myb domain protein 41